Recombinant Human GPC6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y625

Gene Name: GPC6

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Glu371

End Site: Val520

Coverage: 0.31

Isoelectric Point: 4.5

Core Sequence: ERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 55%, Pig - 100%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Glypican-6 [Cleaved into: Secreted glypican-6]

Protein name: glypican 6

Full length: 555 amino acids

Entry name: GPC6_HUMAN

• SKU: ASBPP-1040-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1040-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10082