Recombinant Human GPR50 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13585

Gene Name: GPR50

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 42%

Start Site: Lys461

End Site: Asp610

Coverage: 0.26

Isoelectric Point: 6

Core Sequence: KPDSVHFKPASSNPKPITGHHVSAGSHSKSAFSAATSHPKPTTGHIKPATSHAEPTTADYPKPATTSHPKPTAADNPELSASHCPEIPAIAHPVSDDSDLPESASSPAAGPTKPAASQLESDTIADLPDPTVVTTSTNDYHDVVVIDVED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 42%

Alternative gene names: /

Alternative protein names: Melatonin-related receptor; G protein-coupled receptor 50; H9

Protein name: G protein-coupled receptor 50

Full length: 617 amino acids

Entry name: MTR1L_HUMAN

• SKU: ASBPP-3311-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3311-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9248