Recombinant Human GPS1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13098

Gene Name: GPS1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Tyr91

End Site: Asp170

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: YEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: COPS1; CSN1

Alternative protein names: COP9 signalosome complex subunit 1; SGN1; Signalosome subunit 1; G protein pathway suppressor 1; GPS-1; JAB1-containing signalosome subunit 1; Protein MFH

Protein name: G protein pathway suppressor 1

Full length: 491 amino acids

Entry name: CSN1_HUMAN

• SKU: ASBPP-414-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-414-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 2873