Recombinant Human Glutathione Peroxidase 2 Protein

Recombinant Human Glutathione Peroxidase 2 Protein
SKU
ASBPP-4014-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P18283

Gene Name: GPX2

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Ile190

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Glutathione peroxidase 2; GPx-2; GSHPx-2; Gastrointestinal glutathione peroxidase; Glutathione peroxidase-gastrointestinal; GPx-GI; GSHPx-GI; Glutathione peroxidase-related protein 2; GPRP-2

Protein name: glutathione peroxidase 2

Full length: 190 amino acids

Entry name: GPX2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4014-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4014-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2877
Product information (PDF)
×
MSDS (PDF)
×