Recombinant Human GPX7 Protein

Recombinant Human GPX7 Protein
SKU
ASBPP-3233-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96SL4

Gene Name: GPX7

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gln20

End Site: Leu187

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 43%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: GPX6

Alternative protein names: Glutathione peroxidase 7; GPx-7; GSHPx-7; CL683

Protein name: glutathione peroxidase 7

Full length: 187 amino acids

Entry name: GPX7_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3233-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3233-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2882
Product information (PDF)
×
MSDS (PDF)
×