Recombinant Human GPX8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TED1

Gene Name: GPX8

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Glu51

End Site: Gln200

Coverage: 0.80

Isoelectric Point: 9.5

Core Sequence: EVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWKPEEPIEVIRPDIAALVRQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 38%, Pig - 92%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Probable glutathione peroxidase 8; GPx-8; GSHPx-8

Protein name: glutathione peroxidase 8 (putative)

Full length: 209 amino acids

Entry name: GPX8_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3202-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3202-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 493869