Recombinant Human GRHL3 Protein

Recombinant Human GRHL3 Protein
SKU
ASBPP-3111-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TE85

Gene Name: GRHL3

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Asp411

End Site: Pro480

Coverage: 0.13

Isoelectric Point: 10

Core Sequence: DERKQFRRKVKCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPSAGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Pig - 91%, Cynomolgus monkey - 100%

Alternative gene names: SOM; TFCP2L4

Alternative protein names: Grainyhead-like protein 3 homolog; Sister of mammalian grainyhead; Transcription factor CP2-like 4

Protein name: grainyhead like transcription factor 3

Full length: 626 amino acids

Entry name: GRHL3_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3111-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3111-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57822
Product information (PDF)
×
MSDS (PDF)
×