Recombinant Human GluA4 Protein

Recombinant Human GluA4 Protein
SKU
ASBPP-298-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48058

Gene Name: GRIA4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Asn731

End Site: Ser800

Coverage: 0.09

Isoelectric Point: 8.5

Core Sequence: NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 86%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: GLUR4

Alternative protein names: Glutamate receptor 4; GluR-4; GluR4; AMPA-selective glutamate receptor 4; GluR-D; Glutamate receptor ionotropic; AMPA 4; GluA4

Protein name: glutamate ionotropic receptor AMPA type subunit 4

Full length: 902 amino acids

Entry name: GRIA4_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-298-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-298-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2893
Product information (PDF)
×
MSDS (PDF)
×