Recombinant Human GRIN2A Protein

Recombinant Human GRIN2A Protein
SKU
ASBPP-402-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q12879

Gene Name: GRIN2A

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gln971

End Site: Arg1050

Coverage: 0.05

Isoelectric Point: 10

Core Sequence: QKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 91%, Pig - 90%, Cynomolgus monkey - 95%

Alternative gene names: NMDAR2A

Alternative protein names: Glutamate receptor ionotropic; NMDA 2A; GluN2A; Glutamate [NMDA] receptor subunit epsilon-1; N-methyl D-aspartate receptor subtype 2A; NMDAR2A; NR2A; hNR2A

Protein name: glutamate ionotropic receptor NMDA type subunit 2A

Full length: 1464 amino acids

Entry name: NMDE1_HUMAN

Product panel: Autoimmune Disease,Neuroscience Biomarkers
More Information
SKU ASBPP-402-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-402-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2903
Product information (PDF)
×
MSDS (PDF)
×