Recombinant Human mGluR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13255

Gene Name: GRM1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ala881

End Site: Glu960

Coverage: 0.07

Isoelectric Point: 9

Core Sequence: AGAGNANSNGKSVSWSEPGGGQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 91%, Pig - 95%, Cynomolgus monkey - 96%

Alternative gene names: GPRC1A; MGLUR1

Alternative protein names: Metabotropic glutamate receptor 1; mGluR1

Protein name: glutamate metabotropic receptor 1

Full length: 1194 amino acids

Entry name: GRM1_HUMAN

Product panel: Neuroscience Biomarkers

• SKU: ASBPP-427-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-427-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 2911