Recombinant Human GSTM1 Protein

Recombinant Human GSTM1 Protein
SKU
ASBPP-10500-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P09488

Gene Name: GSTM1

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Glu91

End Site: Ser210

Coverage: 0.57

Isoelectric Point: 6.5

Core Sequence: EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 78%, Pig - 77%, Cynomolgus monkey - 80%

Alternative gene names: GST1

Alternative protein names: Glutathione S-transferase Mu 1; GST HB subunit 4; GST class-mu 1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4

Protein name: glutathione S-transferase mu 1

Full length: 218 amino acids

Entry name: GSTM1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10500-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10500-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2944
Product information (PDF)
×
MSDS (PDF)
×