Recombinant Human GSX1 Protein

Recombinant Human GSX1 Protein
SKU
ASBPP-3177-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H4S2

Gene Name: GSX1

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Ser141

End Site: Leu260

Coverage: 0.49

Isoelectric Point: 9.5

Core Sequence: SNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 57%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: GSH1

Alternative protein names: GS homeobox 1; Homeobox protein GSH-1

Protein name: GS homeobox 1

Full length: 264 amino acids

Entry name: GSX1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3177-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3177-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 219409
Product information (PDF)
×
MSDS (PDF)
×