Recombinant Human GTF3C5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5Q8

Gene Name: GTF3C5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Pro381

End Site: Asp490

Coverage: 0.23

Isoelectric Point: 5

Core Sequence: PASSKYKLKDSVYIFREGALPPYRQMFYQLCDLNVEELQKIIHRNDGAENSCTERDGWCLPKTSDELRDTMSLMIRQTIRSKRPALFSSSAKADGGKEQLTYESGEDEED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%

Alternative gene names: /

Alternative protein names: General transcription factor 3C polypeptide 5; TF3C-epsilon; Transcription factor IIIC 63 kDa subunit; TFIIIC 63 kDa subunit; TFIIIC63; Transcription factor IIIC subunit epsilon

Protein name: general transcription factor IIIC subunit 5

Full length: 519 amino acids

Entry name: TF3C5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2991-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2991-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9328