Recombinant Human GUCA1B Protein

Recombinant Human GUCA1B Protein
SKU
ASBPP-2933-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UMX6

Gene Name: GUCA1B

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Asp51

End Site: Ala170

Coverage: 0.63

Isoelectric Point: 5

Core Sequence: DEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 47%, Pig - 87%, Cynomolgus monkey - 100%

Alternative gene names: GCAP2

Alternative protein names: Guanylyl cyclase-activating protein 2; GCAP 2; Guanylate cyclase activator 1B

Protein name: guanylate cyclase activator 1B

Full length: 200 amino acids

Entry name: GUC1B_HUMAN
More Information
SKU ASBPP-2933-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2933-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2979
Product information (PDF)
×
MSDS (PDF)
×