Recombinant Human GZMH Protein

Recombinant Human GZMH Protein
SKU
ASBPP-3080-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P20718

Gene Name: GZMH

Expression System: Escherichia coli

Molecular Weight: 37.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Glu19

End Site: Leu246

Coverage: 1.00

Isoelectric Point: 9.5

Core Sequence: EEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 63%, Pig - 73%, Cynomolgus monkey - 89%

Alternative gene names: CGL2; CTSGL2

Alternative protein names: Granzyme H; CCP-X; Cathepsin G-like 2; CTSGL2; Cytotoxic T-lymphocyte proteinase; Cytotoxic serine protease C; CSP-C

Protein name: granzyme H

Full length: 246 amino acids

Entry name: GRAH_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3080-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3080-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 2999
Product information (PDF)
×
MSDS (PDF)
×