Recombinant Human H1-10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q92522

Gene Name: H1-10

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Ser31

End Site: Ala200

Coverage: 0.85

Isoelectric Point: 11.5

Core Sequence: SPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 38%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: H1FX

Alternative protein names: Histone H1.10; Histone H1x

Protein name: H1.10 linker histone

Full length: 213 amino acids

Entry name: H1X_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10387-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10387-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8971