Recombinant Human HBD Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P02042

Gene Name: HBD

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Met1

End Site: His147

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 81%, Pig - 84%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Hemoglobin subunit delta; Delta-globin; Hemoglobin delta chain

Protein name: hemoglobin subunit delta

Full length: 147 amino acids

Entry name: HBD_HUMAN

• SKU: ASBPP-3926-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3926-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3045