Recombinant Human HBEGF Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99075

Gene Name: HBEGF

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Leu71

End Site: Gly140

Coverage: 0.45

Isoelectric Point: 8

Core Sequence: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: DTR; DTS; HEGFL

Alternative protein names: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]

Protein name: heparin binding EGF like growth factor

Full length: 208 amino acids

Entry name: HBEGF_HUMAN

• SKU: ASBPP-3105-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3105-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 1839