Recombinant Human HBEGF Protein

Recombinant Human HBEGF Protein
SKU
ASBPP-3105-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99075

Gene Name: HBEGF

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Leu71

End Site: Gly140

Coverage: 0.45

Isoelectric Point: 8

Core Sequence: LLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 76%, Pig - 93%, Cynomolgus monkey - 99%

Alternative gene names: DTR; DTS; HEGFL

Alternative protein names: Proheparin-binding EGF-like growth factor [Cleaved into: Heparin-binding EGF-like growth factor; HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R]

Protein name: heparin binding EGF like growth factor

Full length: 208 amino acids

Entry name: HBEGF_HUMAN
More Information
SKU ASBPP-3105-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3105-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 1839
Product information (PDF)
×
MSDS (PDF)
×