Recombinant Human HBP1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60381

Gene Name: HBP1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Met21

End Site: Trp110

Coverage: 0.21

Isoelectric Point: 3.5

Core Sequence: MDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 87%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: HMG box-containing protein 1; HMG box transcription factor 1; High mobility group box transcription factor 1

Protein name: HMG-box transcription factor 1

Full length: 514 amino acids

Entry name: HBP1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3717-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3717-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 26959