Note: Dry Ice fees will be extra-charged
Uniprot: P08631
Gene Name: HCK
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 79%
Start Site: Glu41
End Site: Glu140
Coverage: 0.21
Isoelectric Point: 4.5
Core Sequence: ETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 79%, Pig - 80%, Cynomolgus monkey - 96%
Alternative gene names: /
Alternative protein names: Tyrosine-protein kinase HCK; Hematopoietic cell kinase; Hemopoietic cell kinase; p59-HCK/p60-HCK; p59Hck; p61Hck
Protein name: HCK proto-oncogene, Src family tyrosine kinase
Full length: 526 amino acids
Entry name: HCK_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
