Recombinant Human HDAC4 Protein

Recombinant Human HDAC4 Protein
SKU
ASBPP-320-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P56524

Gene Name: HDAC4

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Ala91

End Site: Val320

Coverage: 0.21

Isoelectric Point: 10.5

Core Sequence: AEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNNSSGSVSAENGIAPAV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0288

Alternative protein names: Histone deacetylase 4; HD4

Protein name: histone deacetylase 4

Full length: 1084 amino acids

Entry name: HDAC4_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-320-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-320-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9759
Product information (PDF)
×
MSDS (PDF)
×