Note: Dry Ice fees will be extra-charged
Uniprot: Q9Y3E1
Gene Name: HDGFL3
Expression System: Escherichia coli
Molecular Weight: 16 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 96%
Start Site: Lys71
End Site: Ser200
Coverage: 0.66
Isoelectric Point: 6.5
Core Sequence: KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: HDGF2; HDGFRP3
Alternative protein names: Hepatoma-derived growth factor-related protein 3; HRP-3; Hepatoma-derived growth factor 2; HDGF-2
Protein name: HDGF like 3
Full length: 203 amino acids
Entry name: HDGR3_HUMAN
Product panel: Cytokines,DNA binding & Chromatin
English
Deutsch
