Recombinant Human HDGFL3 Protein

Recombinant Human HDGFL3 Protein
SKU
ASBPP-2961-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3E1

Gene Name: HDGFL3

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Lys71

End Site: Ser200

Coverage: 0.66

Isoelectric Point: 6.5

Core Sequence: KFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HDGF2; HDGFRP3

Alternative protein names: Hepatoma-derived growth factor-related protein 3; HRP-3; Hepatoma-derived growth factor 2; HDGF-2

Protein name: HDGF like 3

Full length: 203 amino acids

Entry name: HDGR3_HUMAN

Product panel: Cytokines,DNA binding & Chromatin
More Information
SKU ASBPP-2961-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2961-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 50810
Product information (PDF)
×
MSDS (PDF)
×