Recombinant Human HECTD4 Protein

Recombinant Human HECTD4 Protein
SKU
ASBPP-2967-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y4D8

Gene Name: HECTD4

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Ser3071

End Site: Glu3210

Coverage: 0.03

Isoelectric Point: 4.5

Core Sequence: SICSSQGISQTVSDLSVDPLPAGLELPIPPGLLEPHAVSSQESLDISLCSTGSLGSLGSLGEPLDNAETASVSDMGSMYTVTSLDNQPLAARPIKGFAVVEIRSRAKIEKIRASLFNNNDLIGLSSLDGEDELMEMSTEE

Homologies: Highest protein sequence identity to the following orthologs: Pig - 96%, Cynomolgus monkey - 97%

Alternative gene names: C12orf51; KIAA0614

Alternative protein names: Probable E3 ubiquitin-protein ligase HECTD4; HECT domain-containing protein 4; HECT-type E3 ubiquitin transferase HECTD4

Protein name: HECT domain E3 ubiquitin protein ligase 4

Full length: 3996 amino acids

Entry name: HECD4_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-2967-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2967-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 283450
Product information (PDF)
×
MSDS (PDF)
×