Recombinant Human HINT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P49773

Gene Name: HINT1

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Gly126

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: HINT; PKCI1; PRKCNH1

Alternative protein names: Adenosine 5'-monophosphoramidase HINT1; Desumoylating isopeptidase HINT1; Histidine triad nucleotide-binding protein 1; Protein kinase C inhibitor 1; Protein kinase C-interacting protein 1; PKCI-1

Protein name: histidine triad nucleotide binding protein 1

Full length: 126 amino acids

Entry name: HINT1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4125-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4125-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3094