Recombinant Human HINT2 Protein

Recombinant Human HINT2 Protein
SKU
ASBPP-3984-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BX68

Gene Name: HINT2

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 88%

Start Site: Val18

End Site: Gly163

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: VAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 88%, Rat - 59%

Alternative gene names: /

Alternative protein names: Adenosine 5'-monophosphoramidase HINT2; HINT-3; HIT-17kDa; Histidine triad nucleotide-binding protein 2; mitochondrial; HINT-2; PKCI-1-related HIT protein

Protein name: histidine triad nucleotide binding protein 2

Full length: 163 amino acids

Entry name: HINT2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3984-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3984-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84681
Product information (PDF)
×
MSDS (PDF)
×