Recombinant Human HIRA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P54198

Gene Name: HIRA

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys371

End Site: Val450

Coverage: 0.08

Isoelectric Point: 8

Core Sequence: KSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: DGCR1; HIR; TUPLE1

Alternative protein names: Protein HIRA; TUP1-like enhancer of split protein 1

Protein name: histone cell cycle regulator

Full length: 1017 amino acids

Entry name: HIRA_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-312-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-312-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 7290