Recombinant Human HMGN3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15651

Gene Name: HMGN3

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Met1

End Site: Glu99

Coverage: 1.00

Isoelectric Point: 10.5

Core Sequence: MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 85%, Pig - 94%, Cynomolgus monkey - 100%

Alternative gene names: TRIP7

Alternative protein names: High mobility group nucleosome-binding domain-containing protein 3; Thyroid receptor-interacting protein 7; TR-interacting protein 7; TRIP-7

Protein name: high mobility group nucleosomal binding domain 3

Full length: 99 amino acids

Entry name: HMGN3_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3190-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3190-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9324