Recombinant Human HMGN4 Protein

Recombinant Human HMGN4 Protein
SKU
ASBPP-3191-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O00479

Gene Name: HMGN4

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Met1

End Site: Lys90

Coverage: 1.00

Isoelectric Point: 11

Core Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 83%, Pig - 88%, Cynomolgus monkey - 100%

Alternative gene names: HMG17L3; NHC

Alternative protein names: High mobility group nucleosome-binding domain-containing protein 4; Non-histone chromosomal protein HMG-17-like 3; Non-histone chromosomal protein

Protein name: high mobility group nucleosomal binding domain 4

Full length: 90 amino acids

Entry name: HMGN4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3191-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3191-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10473
Product information (PDF)
×
MSDS (PDF)
×