Recombinant Human HNRNPCL3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: B7ZW38

Gene Name: HNRNPCL3

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Pro131

End Site: Gln290

Coverage: 0.55

Isoelectric Point: 5

Core Sequence: PPPPPIALAVVPSKRQRISGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDLQAIKQELTQIKQKVDSLLENLEKIEKEHCKQGVEVKNAKSEEEQTSSSSKKDKTHVKMESEGGADDSVEEGDLLCDDDNEDQGDNQLELIKDDEKGAEEGEDDRDRANGQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 78%, Pig - 87%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: Heterogeneous nuclear ribonucleoprotein C-like 3

Protein name: heterogeneous nuclear ribonucleoprotein C like 3

Full length: 293 amino acids

Entry name: HNRC3_HUMAN

• SKU: ASBPP-1885-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1885-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 649330