Recombinant Human HNRNPK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P61978

Gene Name: HNRNPK

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Pro11

End Site: Ile100

Coverage: 0.22

Isoelectric Point: 5

Core Sequence: PNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HNRPK

Alternative protein names: Heterogeneous nuclear ribonucleoprotein K; hnRNP K; Transformation up-regulated nuclear protein; TUNP

Protein name: heterogeneous nuclear ribonucleoprotein K

Full length: 463 amino acids

Entry name: HNRPK_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-333-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-333-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3190