Recombinant Human HOXB9 Protein

Recombinant Human HOXB9 Protein
SKU
ASBPP-3705-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P17482

Gene Name: HOXB9

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Leu121

End Site: Cys190

Coverage: 0.33

Isoelectric Point: 8.5

Core Sequence: LLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 83%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX2E

Alternative protein names: Homeobox protein Hox-B9; Homeobox protein Hox-2.5; Homeobox protein Hox-2E

Protein name: homeobox B9

Full length: 250 amino acids

Entry name: HXB9_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3705-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3705-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3219
Product information (PDF)
×
MSDS (PDF)
×