Recombinant Human HOXD1 Protein

Recombinant Human HOXD1 Protein
SKU
ASBPP-3712-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9GZZ0

Gene Name: HOXD1

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Leu241

End Site: Thr310

Coverage: 0.26

Isoelectric Point: 11

Core Sequence: LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQLPLSGTT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 75%, Pig - 89%, Cynomolgus monkey - 99%

Alternative gene names: HOX4; HOX4G

Alternative protein names: Homeobox protein Hox-D1; Homeobox protein Hox-GG

Protein name: homeobox D1

Full length: 328 amino acids

Entry name: HXD1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3712-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3712-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3231
Product information (PDF)
×
MSDS (PDF)
×