Recombinant Human HOXD13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35453

Gene Name: HOXD13

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gly261

End Site: Lys330

Coverage: 0.25

Isoelectric Point: 11

Core Sequence: GDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 40%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: HOX4I

Alternative protein names: Homeobox protein Hox-D13; Homeobox protein Hox-4I

Protein name: homeobox D13

Full length: 343 amino acids

Entry name: HXD13_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3711-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3711-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3239