Recombinant Human Hippocalcin Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P84074

Gene Name: HPCA

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Phe193

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: BDR2

Alternative protein names: Neuron-specific calcium-binding protein hippocalcin; Calcium-binding protein BDR-2

Protein name: hippocalcin

Full length: 193 amino acids

Entry name: HPCA_HUMAN

• SKU: ASBPP-4138-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4138-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3208