Recombinant Human HSD17B10 Protein

Recombinant Human HSD17B10 Protein
SKU
ASBPP-367-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q99714

Gene Name: HSD17B10

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Met1

End Site: Pro261

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 88%, Pig - 90%, Cynomolgus monkey - 97%

Alternative gene names: ERAB; HADH2; MRPP2; SCHAD; SDR5C1; XH98G2

Alternative protein names: 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase; NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH

Protein name: hydroxysteroid 17-beta dehydrogenase 10

Full length: 261 amino acids

Entry name: HCD2_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-367-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-367-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3028
Product information (PDF)
×
MSDS (PDF)
×