Recombinant Human HSF5 Protein

Recombinant Human HSF5 Protein
SKU
ASBPP-3093-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q4G112

Gene Name: HSF5

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Ile461

End Site: Lys590

Coverage: 0.23

Isoelectric Point: 6.5

Core Sequence: IYTIHTAQPVENSTIQESAAIQQAHVKLKEHLNHNPSPSSVVFVQEGPPFSTHQVDANIKCQTSSRENILPSEQMGFLISEMGPASKPSEDTGLATPARYREHRSNSQQGKSPDLHLLVDVACKQERFPK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 86%, Cynomolgus monkey - 99%

Alternative gene names: HSTF5

Alternative protein names: Heat shock factor protein 5; HSF 5; Heat shock transcription factor 5; HSTF 5

Protein name: heat shock transcription factor 5

Full length: 596 amino acids

Entry name: HSF5_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3093-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3093-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 124535
Product information (PDF)
×
MSDS (PDF)
×