Recombinant Human HSPB7 Protein

Recombinant Human HSPB7 Protein
SKU
ASBPP-4207-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBY9

Gene Name: HSPB7

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Gly71

End Site: Ile170

Coverage: 0.64

Isoelectric Point: 6.5

Core Sequence: GAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: CVHSP

Alternative protein names: Heat shock protein beta-7; HspB7; Cardiovascular heat shock protein; cvHsp

Protein name: heat shock protein family B (small) member 7

Full length: 170 amino acids

Entry name: HSPB7_HUMAN
More Information
SKU ASBPP-4207-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4207-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 27129
Product information (PDF)
×
MSDS (PDF)
×