Recombinant Human HTR2C Protein

Recombinant Human HTR2C Protein
SKU
ASBPP-4277-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P28335

Gene Name: HTR2C

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Leu241

End Site: Ser310

Coverage: 0.17

Isoelectric Point: 10.5

Core Sequence: LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 89%, Cynomolgus monkey - 97%

Alternative gene names: HTR1C

Alternative protein names: 5-hydroxytryptamine receptor 2C; 5-HT-2C; 5-HT2C; 5-HTR2C; 5-hydroxytryptamine receptor 1C; 5-HT-1C; 5-HT1C; Serotonin receptor 2C

Protein name: 5-hydroxytryptamine receptor 2C

Full length: 458 amino acids

Entry name: 5HT2C_HUMAN

Product panel: Neuroscience Biomarkers
More Information
SKU ASBPP-4277-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4277-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3358
Product information (PDF)
×
MSDS (PDF)
×