Recombinant Human HTR3E Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A5X5Y0

Gene Name: HTR3E

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Gln81

End Site: Gly230

Coverage: 0.37

Isoelectric Point: 5

Core Sequence: QLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGLTAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQTHGEWELLGLSKATAKLSRG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 38%, Pig - 68%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: 5-hydroxytryptamine receptor 3E; 5-HT3-E; 5-HT3E; Serotonin receptor 3E

Protein name: 5-hydroxytryptamine receptor 3E

Full length: 456 amino acids

Entry name: 5HT3E_HUMAN

• SKU: ASBPP-4317-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4317-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 285242