Recombinant Human ICE1 Protein

Recombinant Human ICE1 Protein
SKU
ASBPP-2951-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2F5

Gene Name: ICE1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Pro11

End Site: Gln190

Coverage: 0.08

Isoelectric Point: 8

Core Sequence: PGTAADLSRCQGCASLQQNLNEYVEALITLKQKIINTDNLLTEYQKKCDELQFARRENSNLHHQVEEMLQKISPLQKCQEELGSLKAELEEKKSSLKLYQDTHQEYARVKEECLKSDAQKKKLEAKVKKLQEAAVKQTQDFKQLRNEKKILEKEFKKTQERLDEFSKQKNEKELRHIGTQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0947

Alternative protein names: Little elongation complex subunit 1; Interactor of little elongator complex ELL subunit 1

Protein name: interactor of little elongation complex ELL subunit 1

Full length: 2266 amino acids

Entry name: ICE1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-2951-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2951-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23379
Product information (PDF)
×
MSDS (PDF)
×