Recombinant Human ICE1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2F5

Gene Name: ICE1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Pro11

End Site: Gln190

Coverage: 0.08

Isoelectric Point: 8

Core Sequence: PGTAADLSRCQGCASLQQNLNEYVEALITLKQKIINTDNLLTEYQKKCDELQFARRENSNLHHQVEEMLQKISPLQKCQEELGSLKAELEEKKSSLKLYQDTHQEYARVKEECLKSDAQKKKLEAKVKKLQEAAVKQTQDFKQLRNEKKILEKEFKKTQERLDEFSKQKNEKELRHIGTQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0947

Alternative protein names: Little elongation complex subunit 1; Interactor of little elongator complex ELL subunit 1

Protein name: interactor of little elongation complex ELL subunit 1

Full length: 2266 amino acids

Entry name: ICE1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-2951-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2951-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23379