Recombinant Human IFNL4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: K9M1U5

Gene Name: IFNL4

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 28%

Start Site: Ala22

End Site: Leu179

Coverage: 1.00

Isoelectric Point: 10.5

Core Sequence: AAPRRCLLSHYRSLEPRTLAAAKALRDRYEEEALSWGQRNCSFRPRRDPPRPSSCARLRHVARGIADAQAVLSGLHRSELLPGAGPILELLAAAGRDVAACLELARPGSSRKVPGAQKRRHKPRRADSPRCRKASVVFNLLRLLTWELRLAAHSGPCL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 28%, Pig - 72%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Interferon lambda-4; IFN-lambda-4

Protein name: interferon lambda 4 (gene/pseudogene)

Full length: 179 amino acids

Entry name: IFNL4_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3718-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3718-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 101180976