Recombinant Human IGFN1 Protein

Recombinant Human IGFN1 Protein
SKU
ASBPP-4254-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86VF2

Gene Name: IGFN1

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Glu21

End Site: Lys160

Coverage: 0.11

Isoelectric Point: 9.5

Core Sequence: EIPEGCSTPDFEQKPVTSALPEGKNAVFRAVVCGEPRPEVRWQNSKGDLSDSSKYKISSSPGSKEHVLQINKLTGEDTDLYRCTAVNAYGEAACSVRLTVIEVGFRKNRKRHREPQEDLRKELMDFRKLLKKRAPPAPKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 36%, Pig - 80%, Cynomolgus monkey - 94%

Alternative gene names: EEF1A2BP1; KYIP1

Alternative protein names: Immunoglobulin-like and fibronectin type III domain-containing protein 1; EEF1A2-binding protein 1; KY-interacting protein 1

Protein name: immunoglobulin like and fibronectin type III domain containing 1

Full length: 1251 amino acids

Entry name: IGFN1_HUMAN
More Information
SKU ASBPP-4254-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4254-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 91156
Product information (PDF)
×
MSDS (PDF)
×