Recombinant Human IGLC2 Protein

Recombinant Human IGLC2 Protein
SKU
ASBPP-3217-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0DOY2

Gene Name: IGLC2

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Leu11

End Site: Val100

Coverage: 0.99

Isoelectric Point: 7.5

Core Sequence: LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Rat - 67%, Pig - 74%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Immunoglobulin lambda constant 2; Ig lambda chain C region Kern; Ig lambda chain C region NIG-64; Ig lambda chain C region SH; Ig lambda chain C region X; Ig lambda-2 chain C region

Protein name: immunoglobulin lambda constant 2

Full length: 106 amino acids

Entry name: IGLC2_HUMAN
More Information
SKU ASBPP-3217-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3217-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3538
Product information (PDF)
×
MSDS (PDF)
×