Recombinant Human IKZF5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H5V7

Gene Name: IKZF5

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: His161

End Site: Thr350

Coverage: 0.47

Isoelectric Point: 10

Core Sequence: HKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSTQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: ZNFN1A5

Alternative protein names: Zinc finger protein Pegasus; Ikaros family zinc finger protein 5

Protein name: IKAROS family zinc finger 5

Full length: 419 amino acids

Entry name: IKZF5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10368-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10368-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64376