Recombinant Human IL20RB Protein

Recombinant Human IL20RB Protein
SKU
ASBPP-3091-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6UXL0

Gene Name: IL20RB

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Start Site: His151

End Site: Ala230

Coverage: 0.32

Isoelectric Point: 5.5

Core Sequence: HLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA

Homologies: Highest protein sequence identity to the following orthologs: Pig - 86%, Cynomolgus monkey - 100%

Alternative gene names: DIRS1

Alternative protein names: Interleukin-20 receptor subunit beta; IL-20 receptor subunit beta; IL-20R-beta; IL-20RB; Fibronectin type III domain containing 6; FNDC6; IL-20R2

Protein name: interleukin 20 receptor subunit beta

Full length: 311 amino acids

Entry name: I20RB_HUMAN
More Information
SKU ASBPP-3091-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3091-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 53833
Product information (PDF)
×
MSDS (PDF)
×