Recombinant Human IL22 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9GZX6

Gene Name: IL22

Expression System: Escherichia coli

Molecular Weight: 59 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Ala34

End Site: Ile179

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: ILTIF; ZCYTO18

Alternative protein names: Interleukin-22; IL-22; Cytokine Zcyto18; IL-10-related T-cell-derived-inducible factor; IL-TIF

Protein name: interleukin 22

Full length: 179 amino acids

Entry name: IL22_HUMAN

Product panel: Cytokines

• SKU: ASBPP-381-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-381-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 50616