Recombinant Human IL23A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NPF7

Gene Name: IL23A

Expression System: Escherichia coli

Molecular Weight: 61 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Arg20

End Site: Pro189

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 82%, Pig - 86%, Cynomolgus monkey - 98%

Alternative gene names: SGRF

Alternative protein names: Interleukin-23 subunit alpha; IL-23 subunit alpha; IL-23-A; Interleukin-23 subunit p19; IL-23p19

Protein name: interleukin 23 subunit alpha

Full length: 189 amino acids

Entry name: IL23A_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3713-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3713-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51561